Exodus!! Lesson*#16* The*Ten*Commandments,*2 nd *Edi8on * (Exodus(34:(1 35)((

Size: px
Start display at page:

Download "Exodus!! Lesson*#16* The*Ten*Commandments,*2 nd *Edi8on * (Exodus(34:(1 35)(("

Transcription

1 Exodus Lesson*#16* The*Ten*Commandments,*2 nd *Edi8on * Exodus34:1 35)

2 Review InLesson#15MoseshasbeenonMt.SinaiwithGodforfortydaysandforty nights,duringwhichgmenoonehasheardfromeithermosesorgod.the IsraelitesconcludethatMosesisdeadandthatGodhasabandonedthem, perhapsrecallinghowgodluredtheegypgansintotheredsea,onlytokill themall.couldgodpossiblyhavedonethesamethingtotheisraelites, luringthemintothewilderness,onlytokillthem? Desperate,theIsraelitesturntoapowerfulandcompassionategodthey know,hathor,thenurturingmotherqgoddessofegypt,whosecenterof worshipis notcoincidently atserabitelqkahdim,notfarfrommt.sinai. ThereAaronsculptsagoldencalf,theiconofthegoddessHathor. AtopMt.SinaiGodtellsMoseswhatisgoingondownbelow,andhevowsto slayalltheisraelitesfortheirdisobedience.moses,inabrilliantandsubtle rhetoricalploy,talksgodoutofit.descendingmt.sinaitotheisraelite camp,moses,inhotanger,smashesthetabletsofthetencommandments andthen disciplines theisraelites,slaughtering3,000oftheirleaders.

3 Preview InLesson#16,aZerse[lingthescorewiththeleadersof the goldencalfrebellion, MosesascendsMt.Sinaionce againtoconferwithgod,whosaystohim: Cuttwo stonetabletsliketheformer,thatimaywriteonthem thewordswhichwereontheformertabletsthat*you* broke Exodus34:1). MosesthenrecommitshimselfandtheIsraelitestoGod s covenant,spendinganaddigonalfortydaysandforty nightsonmt.sinaiinanextraordinarilyingmate relagonshipwithgod.whenmosesdescendsthe mountainhis facehadbecomeradiant Exodus34:29).

4 The*Holy*Bible*with*Illustra8ons*by* Gustave*Doré.*London:Cassel,Pe[er,and Galpin,1866. The*Lord*said*to*Moses:** Cut*two* stone*tablets*like*the*former,*that* I*may*write*on*them*the*words* which*were*on*the*former*tablets* that*you*broke *34:1). AsthegreatmedievalFrenchrabbiRashi A.D.1040Q1105)saidinhiscommentary onthetanakh: Yousmashedthefirst ones,youcarvetheothers.

5 Get*ready*for*tomorrow*morning,*when*you*are*to*go*up* Mount*Sinai*and*there*present*yourself*to*me*on*the*top* of*the*mountain.**no*one*shall*come*up*with*you,*and*let* no*one*even*be*seen*on*any*part*of*the*mountain;*even* the*sheep*and*the*casle*are*not*to*graze*in*front*of*this* mountain 34:2Q3). ThiscommandmentrepeatstheinjuncGoninchapter19 toseparatethepeoplefrommt.sinaiwhengodgives thelaw,butthisgme inlightofthegoldencalfincident theseparagonistotal,withnoa[endantspresenton themountainasbefore.

6 ThisisHEAVY Moses*then*cut*two*stone* tablets*like*the*former,*and* early*the*next*morning*he*went* up*mount*sinai*as*the*lord*had* commanded*him,*taking*in*his* hand*the*two*stone* tablets *34:4).

7 So*the*Lord*passed*before*him*and*proclaimed:** The* Lord,*the*Lord,*a*God*gracious*and*merciful,*slow*to*anger* and*abounding*in*love*and*fidelity,*con8nuing*his*love*for* a*thousand*genera8ons,*and*forgiving*wickedness,* rebellion,*and*sin;*yet*not*declaring*the*guilty*guiltless* [ yethedoesnotwhollyacquit... ],*but*bringing* punishment*for*their*parents *wickedness*on*children*and* children s*children*to*the*third*and*fourth* genera8on 34:6Q7). Asinthe1 st commandment20:5q6),god smercyandloveextends tothethousandthgeneragon,buthispunishmenttothe3 rd and4 th generagon.here,theimplicagonisthatincaseswhereoffenders willfullypersistintheirwickedness,rebellionandsintheycannot expecttobefoundguiltless,forallofgod scompassion:godisa Godoflove,butheisalsoaGodofjusGce.

8 Yes,Lord,we aresgffqnecked, but... Moses,inaskillful rhetoricalmove, carefullyacknowledges God sjusgceandthe Israelites sgffqnecked wickednessandsin, whilepleadingforgod s mercy.

9 Prologue34:10Q11) SmallBookoftheCovenant 1. NocovenantsinCanaan12Q16) 2. Noidols17) 3. KeepPassover18) 4. Consecrate1 st born19q20a) 5. BringgiZs20b) 6. KeeptheSabbath21) 7. KeepFeastofWeeks[Pentecost]22Q24) 8. Noleaven25) 9. KeepFeastofIngathering[Tabernacles]26a) 10. Noboilingyounggoatinmother smilk26b) Epilogue34:27Q28)

10 SmallBookoftheCovenant Prologue34:10Q11) The*Lord*said:* Here*is*the*covenant*I*will*make.**Before*all*your* people*i*will*perform*marvels*never*before*done*in*any*na8on* anywhere*on*earth,*so*that*all*the*people*among*whom*you*live*may* see*the*work*of*the*lord.**awexinspiring*are*the*deeds*i*will*perform* with*you**as*for*you,*observe*what*i*am*commanding*you*today. * OZenreferredtoasthe SmallBookoftheCovenant, thematerialthatfollowsthe ProloguereplicatesmaterialfromtheBookoftheCovenant21Q23),aswellasfromthe TenCommandments20).ThisisnotavariantoftheDecalogue,asmanyofthe commandsarequitesecondary:e.g.,noleaveninsacrificesv.25);noboilingayoung goatinitsmother smilkv.26b).rather,the SmallBookoftheCovenant recallsthe fullerextentofgod scomprehensiveteachingfirstintroducedintheten CommandmentsandtheirapplicaGons,andlaterdevelopedthroughouttheTorah. The SmallBookoftheCovenant funcgonsmuchlikerepeagngthekeystructural notesofamusicalmogfinlatermovementsofa4qmovementsymphony,creagngboth cohesionandforwardmovement.

11 Prologue34:10Q11) SmallBookoftheCovenant 1. NocovenantsinCanaan12Q16) Take*care*not*to*make*a*covenant*with*the*inhabitants*of*the*land* that*you*are*to*enter;*lest*they*become*a*snare*among*you.**tear* down*their*altars;*smash*their*sacred*stones,*and*cut*down*their* asherahs.**you*shall*not*bow*down*to*any*other*god,*for*the*lord Jealous *his*name is*a*jealous*god*.*.*. * Inlightofthegoldencalfepisode,Godissuesasternwarningagainstanyinvolvement withotherculturesandtheirgods,commandingthattheisraelitesdestroytheirplaces ofworship,andimplicitlyforbiddingtheisraelitesfromhavinganypersonal relagonshipswiththeindigenouspeopleofcanaan.twicereferringtosuchpeople prosgtugng themselvestotheirgods[literally, whoringwith ],thecommand includesrawsexualimagery,portrayinggodasisrael sjealous husband or lover, imagerythatbothhoseaandjeremiahvividlydeveloplaterinscripture.

12 Prologue34:10Q11) SmallBookoftheCovenant 1. NocovenantsinCanaan12Q16) 2. Noidols17) You*shall*not*make*for*yourselves*molten*gods. * TheprohibiGonagainstmoltengodsresonatesdeeply,giventhe recentgoldencalfincident.

13 Prologue34:10Q11) SmallBookoftheCovenant 1. NocovenantsinCanaan12Q16) 2. Noidols17) 3. KeepPassover18) You*shall*keep*the*fes8val*of*Unleavened*Bread.*For*seven*days*at*the* appointed*8me*in*the*month*of*abib*you*are*to*eat*no*leavened*bread,* as*i*commanded*you;*for*in*the*month*of*abib*you*came*out*of*egypt. * Passoveristhe*greatarchetypicalactofredempGon,thepivotalevent injewishhistory,andasexodus12:14states,itistobecelebratedin perpetuity.throughachrisganinterpregvelens,passover foreshadowsthesacrificeofchristonthecrossandtheredempgonof allhumanity.

14 Prologue34:10Q11) SmallBookoftheCovenant 1. NocovenantsinCanaan12Q16) 2. Noidols17) 3. KeepPassover18) 4. Consecrate1 st born19q20a) To*me*belongs*every*male*that*opens*the*womb*among*all*your* livestock,*whether*in*the*herd*or*in*the*flock.**the*firstling*of*a*donkey* you*shall*redeem*with*a*lamb;*if*you*do*not*redeem*it,*you*must*break* its*neck.**the*firstborn*among*your*sons*you*shall*redeem. * Aswehavelearned,theEgypGanspracGcedconsecraGonofthefirstborntotheirgods, andbygodkillingallthefirstbornamongtheegypgansinthe10 th plague,hedeprives theegypgangodsofwhatisrighqullytheirs,u[erlydefeagngandplunderingthem.in Exodus13:1Q16GodinsGtutesthepracGcefortheIsraelites.

15 Prologue34:10Q11) SmallBookoftheCovenant 1. NocovenantsinCanaan12Q16) 2. Noidols17) 3. KeepPassover18) 4. Consecrate1 st born19q20a) 5. BringgiZs20b) No*one*shall*appear*before*me*emptyXhanded. * FirstcommandedinExodus23:15,theinjuncGonreflectsstandardsovereign/vassal protocol:whenalesserpersonappearsbeforeagreaterperson,thelesserperson bringsagiz.recallabrahamappearingbeforemelchizedek,kingofsalemandpriestof GodMostHigh.MelchizedekblessesAbraham,andAbrahaminreturngives Melchizedekatenthoftheplunderhetookfromthenorthernkingswhoa[acked SodomGenesis14:18Q20).

16 Prologue34:10Q11) KeeptheSabbath21) SmallBookoftheCovenant Six*days*you*may*labor,*but*on*the*seventh*day*you*shall*rest;*even* during*the*seasons*of*plowing*and*harves8ng*you*must*rest. * TheSabbathisfirstsetasideasadayofrestinGenesis2:2Q3;itis includedascommandment#4inthetencommandments;anditis reiteratedthroughoutscripture.here,theclause even*during*the* seasons*of*plowing*and*harves8ng providesaspecialemphasisfor thoselivinginanagrariansociety,sinceafarmermaybesorely temptedtobreakthesabbathduringtheurgencyofplowingand harvesgngintheagrariancycle.

17 Prologue34:10Q11) KeeptheSabbath21) SmallBookoftheCovenant 7. KeepFeastofWeeks[Pentecost]22Q24) You*shall*keep*the*feast*of*Weeks*[Pentecost]with*the*first*fruits*of*the* wheat*harvest,*likewise*the*feast*of*ingathering*[ Booths ortabernacles]at* the*close*of*the*year.**three*8mes*a*year*all*your*men*shall*appear*before*the* Lord,*the*Lord*God*of*Israel.**Since*I*will*drive*out*the*na8ons*before*you*and* enlarge*your*territory,*no*one*will*covet*your*land*when*you*go*up*three*8mes* a*year*to*appear*before*the*lord*your*god. * TheFeastofUnleavenedBread[Passover],theFeastofWeeks[Pentecost],andthe FeastofIngathering[Tabernacles]arepilgrimagefesGvals,agriculturalcelebraGonswith deepreligioussignificance:passoverrememberstheexodus;pentecostremembersthe givingofthelawatmt.sinai;andtabernaclesremembersthefortyyearsinthe wilderness.

18 Prologue34:10Q11) KeeptheSabbath21) SmallBookoftheCovenant 7. KeepFeastofWeeks[Pentecost]22Q24) 8. Noleaven25) You*shall*not*offer*me*the*blood*of*sacrifice*with*anything*leavened,* nor*shall*the*sacrifice*of*the*passover*feast*be*kept*overnight*for*the* next*day. * Leaven,asymboloremblemofsin,isstrictlyforbiddeninanysacrificetoGod, andthepassoverlambmustbeconsumedontheeveningofpassover anythinglezovermustbeburnedup,ascommandedinexodus12:10, reflecgngtheurgencyofleavingegyptthesamenight.

19 Prologue34:10Q11) KeeptheSabbath21) SmallBookoftheCovenant 7. KeepFeastofWeeks[Pentecost]22Q24) 8. Noleaven25) 9. KeepFeastofIngathering[Tabernacles]26a) The*choicest*first*fruits*of*your*soil*you*shall*bring*to*the*house*of*the* Lord,*your*God. * AsnopersonshallappearemptyQhandedbeforetheLord,soshalleachperson bringthe choicestfirstfruits ofthesoil.goddemandsourbest,notour lezoversseemalachi1:6q8).

20 Prologue34:10Q11) KeeptheSabbath21) SmallBookoftheCovenant 7. KeepFeastofWeeks[Pentecost]22Q24) 8. Noleaven25) 9. KeepFeastofIngathering[Tabernacles]26a) 10. Noboilingyounggoatinmother smilk26b) You*shall*not*boil*a*young*goat*in*its*mother s*milk. * AscommandedintheBookoftheCovenant23:19b),boilingayounggoatin itsmother smilkisfundamentallycruel,transformingamother snurturing milkintoababyanimal sinstrumentofdeath.thecommandisalsotheorigin ofseparagngmeatanddairyinthekosherfoodlawsoflaterjudaism.

21 Prologue34:10Q11)... Epilogue34:27Q28) SmallBookoftheCovenant ThentheLordsaidtoMoses: Writedownthesewords,forinaccordance withthesewordsihavemadeacovenantwithyouandwithisrael.so*moses* was*there*with*the*lord*for*forty*days*and*forty*nights,*without*ea8ng*any* food*or*drinking*any*water,andhewroteonthetabletsthewordsofthe covenant,thetenwords. WhatMosesinscribesonthetabletsiscalled words or commandments [Hebrew, devarim]forthefirstgme.significantly,whengodspoketomosesfromtheburning bushcommandinghimtoreturntoegypt,mosesobjectedsaying, I*am*slow*of*speech* and*tongue, literally: Iamamanwithoutwords[devarim]. HereMosesisaman withwords[devarim]inthehighestpossiblesense. Imbeddingwithinthisdiscourseon words MosesnoteaGngordrinkingfora formulaic fortydaysandfortynights highlightsmosesheroic,superhumaneffortson behalfoftheisraelites.

22 Michelangelo.Moses*marble),c St.PeterinChains,Rome. Moses,horned As*Moses*came*down*from*Mount*Sinai* with*the*two*tablets*of*the*covenant*in* his*hands,*he*did*not*know*that*the*skin* of*his*face*had*become*radiant*while*he* spoke*with*the*lord 34:29). TheHebrewwordqaran,*translatedaboveas radiant, hasthesenseofmoses facebeing luminous,metaphoricallyemiwngraysoflight.in thelagnvulgate,st.jeromefamouslytranslated qaran*as cornuta horned ),emphasizingthe metaphoricalsense.manyreadershowever, includingmichelangelo,read cornuta literally, resulgnginmosessporgngasetofhorns. Thisdivinefireorluminosityinone sfaceazer beinginthepresenceofgodiscapturedstylisgcally inotherworksasahalo.

23 QuesGonsfordiscussionandthought ** 1. Chapter34openswithacomictouch.Why? 2. AZerthegoldencalfincidentGoddistanceshimselffromhis people.howdoesournarragveaccomplishthis? 3. Godisfrighteninglyseriousinhisresponsetothegoldencalf incident,emphasizingthatalthoughagodofmercyand aboundinginlove,hewillnotforgivethosewhowillfullyand persistentlysin.howdoesmosesusegod sveryclear statementinconvincinggodtopardontheisraelites,exactly whathesaidhewon tdo? 4. Howdoesthe SmallBookoftheCovenant funcgoninthis secgonofscripture?whydoesitoccupysomuchofchapter 34? 5. WhydoesMosesveilhimselfwhenhefinishesspeakingtothe Israelites?

24 Copyright 2014byWilliamC.Creasy All rights reserved. No part of this course audio, video, photography, maps, Gmelines or other media may be reproducedortransmi[edinanyformbyanymeans,electronic or mechanical, including photocopying, recording or by any informagon storage or retrieval devices without permission in wrigngoralicensingagreementfromthecopyrightholder.

Lesson&#12& Parables,&Part&2& (15:&1& &19:&27)&

Lesson&#12& Parables,&Part&2& (15:&1& &19:&27)& Lesson&#12& Parables,&Part&2& (15:&1& &19:&27)& 1" On#the#journey#to#Jerusalem,#Jesus#enthralled#the#crowds#with#his# teaching,#responding#to#ques9ons#people#asked#him,#commen9ng#on# current#events#and#warning#the#crowds#of#conflict#to#come.##his#teaching#

More information

Exodus!! Lesson*#12* Book*of*the*Covenant,*Part*2 * (Exodus(22:(6( (24:(18)((

Exodus!! Lesson*#12* Book*of*the*Covenant,*Part*2 * (Exodus(22:(6( (24:(18)(( Exodus Lesson*#12* Book*of*the*Covenant,*Part*2 * Exodus22:6 24:18) Review InLesson#10,welearnedthatthecovenantsBpulaBonstheTen Commandments,orten principles )mustbeappliedinspecific cases,andwebeganexploringthebookofthecovenantexodus20:

More information

Exodus!! Lesson*#18* Excursus:* The*Pillar*of*Cloud*and*Fire *

Exodus!! Lesson*#18* Excursus:* The*Pillar*of*Cloud*and*Fire * Exodus Lesson*#18* Excursus:* The*Pillar*of*Cloud*and*Fire * Review InLesson#17,wewitnessedthefashioningoftheTabernacle, exquisiteinitslapidarybeautyanddazzlingcolorsofviolet,purple andscarlet;gold,silverandbronze.whenmoseserectsthe

More information

Exodus!! Lesson*#11* Book*of*the*Covenant,*Part*1 * (Exodus(21:(1( (22:(5)((

Exodus!! Lesson*#11* Book*of*the*Covenant,*Part*1 * (Exodus(21:(1( (22:(5)(( Exodus Lesson*#11* Book*of*the*Covenant,*Part*1 * Exodus21:1 22:5) Review InLessons#9and#10,GodreaffirmedwiththeIsraelitesthecovenant hemadewithabraham,isaacandjacob.andwelearnedthatthe covenantfolloweda6jpartstandardizedformcommontomany

More information

Exodus!! Lesson*#17* Building*the*Tabernacle * (Exodus(35:(1( (40:(38)((

Exodus!! Lesson*#17* Building*the*Tabernacle * (Exodus(35:(1( (40:(38)(( Exodus Lesson*#17* Building*the*Tabernacle * Exodus35:1 40:38) Review InExodus25:31Mosesreceivedthe blueprints forconstrucfngthe Tabernacle,theplaceonearthwhereGodwilldwellamonghis covenantpeople.ashebrews8pointsout,thisearthlytabernacleis

More information

Exodus!! Lesson*#9* God*Reaffirms*the*Covenant * (Exodus(19:(1,25)((

Exodus!! Lesson*#9* God*Reaffirms*the*Covenant * (Exodus(19:(1,25)(( Exodus Lesson*#9* God*Reaffirms*the*Covenant * Exodus19:1,25) Review InLesson#8theIsraelitesbegantheirjourneythroughthe wilderness,makingtheirwaytomt.sinai,themountainofgod, alongthewaypassingthroughthewildernessofshur,marah,elim,

More information

Mark!! Lesson*#6* The*Eye*of*the*Storm,* Jesus *Teaching,*Preaching*and*Healing* (4:*1* *6:*6)*

Mark!! Lesson*#6* The*Eye*of*the*Storm,* Jesus *Teaching,*Preaching*and*Healing* (4:*1* *6:*6)* Mark Lesson*#6* The*Eye*of*the*Storm,* Jesus *Teaching,*Preaching*and*Healing* (4:*1* *6:*6)* Review InLesson#5conflictintensifieddrama6cally:JesuscalledLevi,a hatedjewishtaxcollector,tobecomeoneofhisinnercircle;jesus

More information

Exodus!! Lesson*#4* Moses*Confronts*Pharaoh * (Exodus(5:(1( (7:(7)((

Exodus!! Lesson*#4* Moses*Confronts*Pharaoh * (Exodus(5:(1( (7:(7)(( Exodus Lesson*#4* Moses*Confronts*Pharaoh * Exodus5:1 7:7) Review AsweenteredLesson#3Moseswas80yearsold,amanattheendofhis life.adoptedbypharaoh sdaughter,moseshadgrownupinthepalaceof Pharaohasa PrinceofEgypt,

More information

Exodus!! Lesson*#7* The*Exodus * (Exodus(12:(36( (15:(21)((

Exodus!! Lesson*#7* The*Exodus * (Exodus(12:(36( (15:(21)(( Exodus Lesson*#7* The*Exodus * Exodus12:36 15:21) Review Thecumula

More information

Mark!! Lesson*#16* Peter s*denial* (Mark*14:*27972)* Judas,!the!Betrayer!

Mark!! Lesson*#16* Peter s*denial* (Mark*14:*27972)* Judas,!the!Betrayer! Mark Lesson*#16* Peter s*denial* (Mark*14:*27972)* Judas,theBetrayer 1 Review InLesson#15weexploredthecharacterandmo9vesof Judasthebetrayer,drawingonMaBhew,LukeandJohn andafewoutsidesources foraddi9onalinforma9on.

More information

Lesson&#8& For&unto&you&a&child&is&born&.&.&. & (Levi&cus*12:*1.8)* For$unto$you$a$child$is$born$.$.$.$ 1$

Lesson&#8& For&unto&you&a&child&is&born&.&.&. & (Levi&cus*12:*1.8)* For$unto$you$a$child$is$born$.$.$.$ 1$ Lesson&#8& For&unto&you&a&child&is&born&.&.&. & (Levi&cus*12:*1.8)* For$unto$you$a$child$is$born$.$.$.$ 1$ Lessons*1.6*focused*on*Levi&cus,*Part*1:**Sacrifice,*the*means*by*which*a* sinful*people*gain*access*to*an*infinitely*holy*god.**with*lesson*#7*we*

More information

Lesson&#6& Nadab&and&Abihu&Toasted!& (Levi&cus*10:*1.20)*

Lesson&#6& Nadab&and&Abihu&Toasted!& (Levi&cus*10:*1.20)* Lesson&#6& Nadab&and&Abihu&Toasted!& (Levi&cus*10:*1.20)* Nadab%and%Abihu%Toasted!% 1% In*Lesson*#5*we*saw*Aaron*and*his*four*sons Nadab,*Abihu,*Eleazar*and* Ithamar ordained*for*the*priesthood,*and*we*learned*the*importance*of*

More information

Mark!! Lesson*#18* The*Crucifixion* (Mark*15:*21:47)*

Mark!! Lesson*#18* The*Crucifixion* (Mark*15:*21:47)* Mark Lesson*#18* The*Crucifixion* (Mark*15:*21:47)* Review InLesson#17weexaminedMark sterserenderingofjesus trial beforepon?uspilate.foundguiltyofblasphemybythesanhedrin,a capitaloffenceundermosaiclaw,romanlawforbadethejewsfrom

More information

Lesson&#12& The&Scapegoat& (Levi&cus*16:*20022a)*

Lesson&#12& The&Scapegoat& (Levi&cus*16:*20022a)* Lesson&#12& The&Scapegoat& (Levi&cus*16:*20022a)* The$Scapegoat$ 1$ All*year*long*Israel s*sins*have*been*pollu&ng*the*sanctuary.**although* individuals*have*brought*purifica&on*offerings*to*cleanse*the*sanctuary*of*

More information

Lesson&#20& The&Resurrec0on& (24:%1'52)%

Lesson&#20& The&Resurrec0on& (24:%1'52)% Lesson&#20& The&Resurrec0on& (24:%1'52)% 1" The%Persians%introduced%crucifixion%as%a% capital%punishment%as%early%as%the%6 th % century%b.c.,%and%the%carthaginians,% Macedonians%and%Romans%employed%it%unFl%

More information

Lesson&#1& Introduc/on&

Lesson&#1& Introduc/on& Lesson&#1& Introduc/on& Introduc)on*to*Luke* 1* In#our#study#of#the#Gospel&according&to&Ma7hew,#we#defined#a# gospel # as#a#unique#literary#genre,#an#account#of#the# good#news #(Greek#=# euangelion;&eu#=##

More information

Lesson&#3& Infancy&Narra0ve,&Part&1& (1:&5980)& Infancy"Narra+ve,"Part"1"

Lesson&#3& Infancy&Narra0ve,&Part&1& (1:&5980)& InfancyNarra+ve,Part1 Lesson&#3& Infancy&Narra0ve,&Part&1& (1:&5980)& 1" A"er%Luke s%elegant,%423word%single3sentence%prologue%in% vv.%134,%he%shi"s%his%prose%style%drama@cally,%crea@ng%an% en@re%cast%of%characters including%a%narrator

More information

Lesson&#4& Infancy&Narra0ve,&Part&2& (2:&1952)& Infancy"Narra+ve,"Part"2"

Lesson&#4& Infancy&Narra0ve,&Part&2& (2:&1952)& InfancyNarra+ve,Part2 Lesson&#4& Infancy&Narra0ve,&Part&2& (2:&1952)& 1" In#Lesson##3#we#saw#that#Luke#begins#his#gospel#with#the#Annuncia7on,# God s#offer#to#mary#that#she#become#the#mother#of#his#son,#an#offer# that#is#framed#by#god

More information

Lesson&#20& Coda& Coda% 1%

Lesson&#20& Coda& Coda% 1% Lesson&#20& Coda& Coda% 1% Exodus'20'through'Levi2cus'26'expresses'God s'covenant'with'the' Israelites'in'its'totality.''Levi2cus'27'then'func2ons'much'like'an' appendix'to'the'covenant,'and'its'topic'is'vows&and'dedica1ons

More information

Lesson&#5& Prelude&to&Ministry& (3:&1& &4:&13)&

Lesson&#5& Prelude&to&Ministry& (3:&1& &4:&13)& Lesson&#5& Prelude&to&Ministry& (3:&1& &4:&13)& 1" With%John s%birth%in%chapter%1,%we%moved%seamlessly%to%jesus % birth%in%chapter%2.%%as%lesson%#4%opened,%luke%set%the%scene,% both%historically%and%geographically.%%historically,%the%scene%

More information

Lesson&#16& St.&Paul s&journey&to&jerusalem& (20:&1& &21:&14)& St.$Paul's$Journey$to$Jerusalem$ 1$

Lesson&#16& St.&Paul s&journey&to&jerusalem& (20:&1& &21:&14)& St.$Paul's$Journey$to$Jerusalem$ 1$ Lesson&#16& St.&Paul s&journey&to&jerusalem& (20:&1& &21:&14)& 1$ On#the#way#home#from#Corinth#St.#Paul#stopped#in#Ephesus,#the#major#deep; water#port#on#the#west#coast#of#asia#minor#and#the#hub#of#mari@me#trade:##paul#

More information

Lesson&#3& St.&Peter&Arrested!& (3:&1& &4:&31)&

Lesson&#3& St.&Peter&Arrested!& (3:&1& &4:&31)& Lesson&#3& St.&Peter&Arrested!& (3:&1& &4:&31)&! 1$ A"er%Jesus %resurrec+on%he%spent%40%days%with%his%disciples,%teaching% them%what%they%needed%to%know%to%take%the%gospel%to%the%ends%of%the% earth,%and%he%commissioned%them%as%

More information

Lesson&#5& The&Ordina0on&of&Aaron&and&His&Sons& (Levi&cus*8:*1* *9:*24)* Ordina'on)of)Aaron)and)His)Sons) 1)

Lesson&#5& The&Ordina0on&of&Aaron&and&His&Sons& (Levi&cus*8:*1* *9:*24)* Ordina'on)of)Aaron)and)His)Sons) 1) Lesson&#5& The&Ordina0on&of&Aaron&and&His&Sons& (Levi&cus*8:*1* *9:*24)* Ordina'on)of)Aaron)and)His)Sons) 1) Whereas*Lessons*2*&*3*addressed*God s*covenant*people,*introducing*the* sacrificial*system*with*its*

More information

Lesson&#6& Moving&Out&from&Jerusalem& (8:&4& &40)&! Moving'Out'from'Jerusalem' 1'

Lesson&#6& Moving&Out&from&Jerusalem& (8:&4& &40)&! Moving'Out'from'Jerusalem' 1' Lesson&#6& Moving&Out&from&Jerusalem& (8:&4& &40)&! 1' With%the%Church%speeding%ahead,%increasing%fric3on%from%within%and% unexpected%bumps%on%the%road%threatened%to%spin%the%church%off%track%and% destroy%it.%%we%read%that%

More information

Lesson&#19& The&Resurrec0on& (Mark&16:&178)&

Lesson&#19& The&Resurrec0on& (Mark&16:&178)& Lesson&#19& The&Resurrec0on& (Mark&16:&178)& In#Lesson##18#we#examined#the#crucifixion#in#detail.##We#followed#the# sequence#of#events,#from#pon?us#pilate#handing#jesus#over#to#his# execu?oners;#the#roman#soldiers#flogging#jesus#nearly#to#death,#

More information

UNIT 1 MY SPIRITUAL LIFE UNIT 2 MEDIA UNIT 3 SERVICE VOLUME 8. LEARNER MAGAZINE

UNIT 1 MY SPIRITUAL LIFE UNIT 2 MEDIA UNIT 3 SERVICE VOLUME 8. LEARNER MAGAZINE UNIT 1 MY SPIRITUAL LIFE UNIT 2 MEDIA UNIT 3 SERVICE VOLUME 8. LEARNER MAGAZINE MY SPIRITUAL LIFE... 5 2 FLYTE MEDIA... 19 SERVICE... 33 VOLUME 8 3 2013 LifeWay Press No part of this work may be reproduced

More information

Lesson&#5& Moun+ng&Opposi+on& (6:&8& &8:&3)&

Lesson&#5& Moun+ng&Opposi+on& (6:&8& &8:&3)& Lesson&#5& Moun+ng&Opposi+on& (6:&8& &8:&3)&! 1' Lesson&#4&transported&us&back&to&the&forma5ve&days&of&the&Church,&a& 5me&when& the&community&of&believers&was&of&one&heart&and&mind,&and& no&one&claimed&that&any&of&his&possessions&was&his&own,&but&they&had&

More information

Lesson&#9& St.&Peter&and&Cornelius& (9:&32& &11:&18)& St.$Peter$&$Cornelius$ 1$

Lesson&#9& St.&Peter&and&Cornelius& (9:&32& &11:&18)& St.$Peter$&$Cornelius$ 1$ Lesson&#9& St.&Peter&and&Cornelius& (9:&32& &11:&18)& 1$ Lesson&#8&offered&an&excursus&on&St.&Paul.&&Next&to&Jesus&himself,&St.& Paul&is&the&towering&figure&in&the&New&Testament.&&Raised&in&Tarsus,&son&

More information

Lesson&#9& Eeeeew!&&What s&that?& Of&scaly&infec9ons,&mold&and&mildew& (Levi&cus*13:*1* *14:*57)* Eeeeew!%%What's%That?% 1%

Lesson&#9& Eeeeew!&&What s&that?& Of&scaly&infec9ons,&mold&and&mildew& (Levi&cus*13:*1* *14:*57)* Eeeeew!%%What's%That?% 1% Lesson&#9& Eeeeew!&&What s&that?& Of&scaly&infec9ons,&mold&and&mildew& (Levi&cus*13:*1* *14:*57)* Eeeeew!%%What's%That?% 1% In*Lesson*#8*we*addressed*a*lingering*ques&on*from*Lesson*#9*about*the* dietary*restric&ons*in*levi&cus*11.**if*properly*followed*the*dietary*restric&ons*

More information

Lesson&#2& The&Prologue& (1:$1%18)$

Lesson&#2& The&Prologue& (1:$1%18)$ Lesson&#2& The&Prologue& (1:$1%18)$ 1" In$Lesson$#1$we$learned$that$the$Johannine$canon$consists$of$the$Gospel& according&to&john;$1,&2&and&3&john;$and$the$book&of&revela@on,$and$we$ learned$that$the$johannine$material$differs$radically$from$the$other$books$of$

More information

Lesson&#1& Introduc)on*to*the*Johannine*Canon* and*the*gospel&according&to&john& Introduc+on"

Lesson&#1& Introduc)on*to*the*Johannine*Canon* and*the*gospel&according&to&john& Introduc+on Lesson&#1& Introduc)on*to*the*Johannine*Canon* and*the*gospel&according&to&john& 1" Welcome*to*our*study*of*The& Gospel&according&to&John,*the* first*in*this*series*on*the* Johannine*Canon, *which* includes:*

More information

Lesson&#7& Things&Are&Not&What&They&Seem& (6:&17& &7:&50)& Things"Are"Not"What"They"Seem"

Lesson&#7& Things&Are&Not&What&They&Seem& (6:&17& &7:&50)& ThingsAreNotWhatTheySeem Lesson&#7& Things&Are&Not&What&They&Seem& (6:&17& &7:&50)& 1" In#a#very#nice#literary#move,#Lesson##6#opened#with#Luke#moving#Jesus # rejec>on#at#nazareth#to#the#beginning#of#his#public#ministry,#rather#than#

More information

Lesson&#19& The&Crucifixion& (23:%1'56)% The"Crucifixion"

Lesson&#19& The&Crucifixion& (23:%1'56)% TheCrucifixion Lesson&#19& The&Crucifixion& (23:%1'56)% 1" Lessons%17%&%18%offered%excursuses%on%the%characters%and%possible%moAvaAons% of%both%judas%and%st.%peter%in%the%lead'up%to%jesus %arrest%and%trial.%%we%learned%

More information

Scripture quotations marked NKJV are taken from the New King James Version. Copyright 1982 by Thomas Nelson. Used by permission. All rights reserved.

Scripture quotations marked NKJV are taken from the New King James Version. Copyright 1982 by Thomas Nelson. Used by permission. All rights reserved. All Scripture quotations, unless otherwise indicated, are taken from the Holy Bible, New International Version, NIV. Copyright 1973, 1978, 1984, 2011 by Biblica, Inc. Used by permission of Zondervan. All

More information

Lesson&#8& Excursus:&&A&Portrait&of&St.&Paul& Excursus,(A(Portrait(of(St.(Paul( 1(

Lesson&#8& Excursus:&&A&Portrait&of&St.&Paul& Excursus,(A(Portrait(of(St.(Paul( 1( Lesson&#8& Excursus:&&A&Portrait&of&St.&Paul& 1( We#first#met#Saul#at#the#stoning#of#Stephen,#where#he#supervised#Steven s# murder.##on#that#same#day,#saul#began# trying&to&destroy&the&church;& entering&house&a>er&house&and&dragging&out&men&and&women,&he&handed&

More information

Lesson&#15& 3rd&Missionary&Journey& (18:&24& &19:&40)&

Lesson&#15& 3rd&Missionary&Journey& (18:&24& &19:&40)& Lesson&#15& 3rd&Missionary&Journey& (18:&24& &19:&40)& 1$ On#the#2 nd #missionary#journey,#paul#&#company#le8#philippi#and#con9nued# westward#to#thessalonica#and#berea.##a8er#trouble#in#berea,#paul s#

More information

praying through Exodus for the Dong people of China

praying through Exodus for the Dong people of China serving before the altar The Dong people of China are largely unknown to the world, yet are precious to God. Most of us will never even meet one Dong person, but we can still have a profound effect for

More information

Lesson&#17& Excursus:&&Judas,&the&Betrayer& Excursus:""Judas"the"Betrayer"

Lesson&#17& Excursus:&&Judas,&the&Betrayer& Excursus:JudastheBetrayer Lesson&#17& Excursus:&&Judas,&the&Betrayer& 1" In#Lesson##16#events#unfolded#exactly#as#Jesus#planned:## Judas#agreed#to#betray#Jesus;#Jesus#and#his#disciples#shared# the#passover#meal;#jesus#was#arrested#in#the#garden#of#

More information

Lesson&#11& Parables,&Part&1& (12:&1& &14:&35)&

Lesson&#11& Parables,&Part&1& (12:&1& &14:&35)& Lesson&#11& Parables,&Part&1& (12:&1& &14:&35)& 1" In#Lesson##10#we#entered#the#2nd#Phase#of#Jesus #public#ministry,#as#he# and#his#disciples#headed#south#toward#jerusalem#and#the#cross.##en# route,#jesus#sent#ahead#72#disciples,#an#

More information

Copyrighted material Your Comeback Workbook.indd 1 2/13/18 3:09 PM

Copyrighted material Your Comeback Workbook.indd 1 2/13/18 3:09 PM All Scripture quotations are taken from the New American Standard Bible, 1960, 1962, 1963, 1968, 1971, 1972, 1973, 1975, 1977, 1995 by The Lockman Foundation. Used by permission. (www.lockman.org) Cover

More information

Lesson&#1& Prologue& Stay&in&the&city&un6l&you&are&clothed&with&power&from&on&high!(Acts!1:!1)26).! Prologue! 1!

Lesson&#1& Prologue& Stay&in&the&city&un6l&you&are&clothed&with&power&from&on&high!(Acts!1:!1)26).! Prologue! 1! Lesson&#1& Prologue& Stay&in&the&city&un6l&you&are&clothed&with&power&from&on&high!(Acts!1:!1)26).! 1! The!Gospel&according&to&Luke!and!the!Acts&of&the&Apostles!comprise!two! parts!of!a!single,!unified!literary!work.!!at!the!end!of!luke

More information

Moses: Learning to Lead Copyright 2003, 2016 by Catherine Schell

Moses: Learning to Lead Copyright 2003, 2016 by Catherine Schell All Scripture quotations, unless otherwise indicated, are taken from the Holy Bible, New International Version, NIV. Copyright 1973, 1978, 1984, 2011 by Biblica, Inc. Used by permission of Zondervan. All

More information

Eight sessions from Deuteronomy

Eight sessions from Deuteronomy There Is No Other Eight sessions from The Crusader Union is a Bible-based, interdenominational Christian youth organisation, whose vision is to proclaim the Gospel of Jesus Christ to students in the Independent

More information

Copyright Felice Gerwitz, Media Angels, Inc. All Rights Reserved. For individual or family use only.

Copyright Felice Gerwitz, Media Angels, Inc. All Rights Reserved. For individual or family use only. Copyright 2012 Media Angels, Inc. By Felice Gerwitz, All Rights Reserved. Media Angels, Inc. Ft. Myers, FL 33912 All rights reserved. No part of this book may be reproduced, stored in a retrieval system,

More information

The Golden Calf. Bible Passage: Exodus 32 and 34. Story Point: God s people worshiped a golden calf. Key Passage:

The Golden Calf. Bible Passage: Exodus 32 and 34. Story Point: God s people worshiped a golden calf. Key Passage: March 31st 6.1 Kinder Lesson Plan The Golden Calf Bible Passage: Exodus 32 and 34 Story Point: God s people worshiped a golden calf. Key Passage: The Lord is my strength and my song, and He has become

More information

Philippians. A Message of Encouragement. Published by Q Place. Marilyn Kunz & Catherine Schell

Philippians. A Message of Encouragement. Published by Q Place. Marilyn Kunz & Catherine Schell Philippians A Message of Encouragement Marilyn Kunz & Catherine Schell Published by Q Place 1 All Scripture quotations, unless otherwise indicated, are taken from the Holy Bible, New International Version,

More information

Change: Facing the Unexpected Copyright 2016 by Q Place Copyright 2004 by Beth Seversen

Change: Facing the Unexpected Copyright 2016 by Q Place Copyright 2004 by Beth Seversen All Scripture quotations, unless otherwise indicated, are taken from the Holy Bible, New International Version, NIV. Copyright 1973, 1978, 1984, 2011 by Biblica, Inc. Used by permission of Zondervan. All

More information

Life. the. jesus. Leader s Guide

Life. the. jesus. Leader s Guide Life the of jesus Leader s Guide The Deeper Connections Series The Miracles of Jesus The Last Days of Jesus The Forgiveness of Jesus The Life of Jesus Deeper Connections Life the of jesus Leader s Guide

More information

You Cannot Prove. The Existence Of God!

You Cannot Prove. The Existence Of God! 1 of 6 You Cannot Prove By Mark McGee 2 of 6 I was an atheist when I first said that to a Christian more than 50 years ago. I must say it felt pretty good to say those words. It makes one feel superior

More information

Facing the Unexpected. Beth Seversen Dobbs, Ferry, NY

Facing the Unexpected. Beth Seversen Dobbs, Ferry, NY CHANGE Facing the Unexpected Beth Seversen 8 Discussions for Group Bible Study Neighborhood Bible Studies Publishers Neighborhood 56 Main Street Bible Studies Publishers 56 P.O. Main Dobbs Box Street Ferry,

More information

- Junior - Unless otherwise indicated, all Scripture quotations are from the Holy Bible, King James Version (KJV).

- Junior - Unless otherwise indicated, all Scripture quotations are from the Holy Bible, King James Version (KJV). - Junior - Copyright 2018 by Kim Sorgius ALL RIGHTS RESERVED This book contains materials protected under international and Federal Copyright Laws and Treaties Any unauthorized reprint or use of this material

More information

C O M P L E T E L E A R N I N G S Y S T E M. Resource & Activity Book. Samuel the Lamanite

C O M P L E T E L E A R N I N G S Y S T E M. Resource & Activity Book. Samuel the Lamanite C O M P L E T E L E A R N I N G S Y S T E M Resource & Activity Book TM Samuel the Lamanite By: Laurie Bonnell Stephens, Melissa Johns, Bryan Jensen, Margie Lee, Eric Fenton and Sonja Jorgenson Parent

More information

God Manifested: In the Flame and in the Flesh. by David A. Huston

God Manifested: In the Flame and in the Flesh. by David A. Huston God Manifested: In the Flame and in the Flesh by David A. Huston This article is presented to show that the biblical God is the One who has manifested Himself in the flesh. AS MOSES WAS LEADING HIS FLOCK

More information

BECOMING A SUCCESSFUL COACH WORKBOOK

BECOMING A SUCCESSFUL COACH WORKBOOK THE MOMENT WE SEE OURSELVES AS OUR OWN SOURCE OF INSPIRATION WE BEGIN THE JOURNEY OF MASTERY OF OUR OWN THOUGHTS AND CHOICES. YOUR PERSONAL DISCOVERY EXERCISE 1. WHAT IS MY PURPOSE? Is it to give to others?

More information

The Setting. Exodus 19:1-2 (NIV) On the first day of the third month after the Israelites left

The Setting. Exodus 19:1-2 (NIV) On the first day of the third month after the Israelites left Exodus 19:1-2 (NIV) On the first day of the third month after the Israelites left The Setting Egypt on that very day they came to the Desert of Sinai. 2 After they set out from Rephidim, they entered the

More information

Biblical Feasts and Holy Days

Biblical Feasts and Holy Days Biblical Feasts and Holy Days A Chronological Study of the Sabbath, the Seven Feasts of the Lord, and Purim. Teacher Sample Elementary P.O. Box 2123 Glenrock, WY 82637 Website: www.grapevinestudies.com

More information

first mike slaughter Children s Leader Guide putting God first in living and giving

first mike slaughter Children s Leader Guide putting God first in living and giving a SLAUGHTER / HOELSCHER Children s Leader Guide Based on Mike Slaughter s inspiring new book and video, shiny gods: finding freedom from things that distract us In this exciting new study for children,

More information

LIVE WORSHIP What Does It Mean to Live a Life of Worship?

LIVE WORSHIP What Does It Mean to Live a Life of Worship? LIVE WORSHIP What Does It Mean to Live a Life of Worship? Rosilind Jukić www.littlerandr.org 2013 All Rights Reserved All Scripture verses are taken from the New King James version of the Holy Bible. All

More information

Also by Chris Zanetti: Superhuman Training A Guide to Unleashing Your Supernatural Powers Mystical Words of Power A Collection of Original & Powerful

Also by Chris Zanetti: Superhuman Training A Guide to Unleashing Your Supernatural Powers Mystical Words of Power A Collection of Original & Powerful Also by Chris Zanetti: Superhuman Training A Guide to Unleashing Your Supernatural Powers Mystical Words of Power A Collection of Original & Powerful Poetry Volume 1 Angels A Collection of Original Angel

More information

Lesson&#11& 1 st &Missionary&Journey& (13:&1& &14:&28)& 1st$Missionary$Journey$ 1$

Lesson&#11& 1 st &Missionary&Journey& (13:&1& &14:&28)& 1st$Missionary$Journey$ 1$ Lesson&#11& 1 st &Missionary&Journey& (13:&1& &14:&28)& 1$ In#Lesson##10#the#Church#in#Jerusalem#sent#Barnabas#to# Syrian#An;och,#where#Gen;les#were#ac;vely#being# prosely;zed.##it#was#one#thing#for#cornelius#and#his#family#

More information

Session 4 PRESCHOOL UNIT 4

Session 4 PRESCHOOL UNIT 4 BIBLE STUDY God led His people into the wilderness, but He did not leave them there alone. The Lord was with His people. He provided meat, bread, and water. He guided them to Mount Sinai, where He met

More information

Lentenn Prayer Journal For Women. Carol D Annunzio

Lentenn Prayer Journal For Women. Carol D Annunzio Lentenn Prayer Journal For Women Carol D Annunzio Living Fire Publications Copyright 2016 by Living Fire Publications All rights reserved. No part of this book may be reproduced or transmitted in any form

More information

What Is Pentecost? A Teaching Guide for the Booklet. by Marcia Stoner

What Is Pentecost? A Teaching Guide for the Booklet. by Marcia Stoner A Teaching Guide for the Booklet by Marcia Stoner A Teaching Guide for the Booklet Copyright 2011 Abingdon Press All rights reserved. No part of this work, EXCEPT PAGE COVERED BY THE FOLLOWING NOTICE,

More information

PUT ASUNDER. by Craig Allan Pospisil

PUT ASUNDER. by Craig Allan Pospisil 1 PUT ASUNDER by Craig Pospisil Contact: Bruce Miller Washington Square Arts 310 Bowery, 2 nd flr. New York, NY 10012 Ph: 212-253-0333, ext. 36 bmiller@washingtonsquarearts.com. Copyright 2006 www.washingtonsquarearts.com

More information

VENANT. Sample Session

VENANT. Sample Session C VENANT G O D S E N D U R I N G P R O M I S E S K A Y A R T H U R Sample Session Overview Week 1, Day 5 along with the contents page (attached) to consider how a group study could work in your church

More information

UNIT 1 MY SPIRITUAL LIFE UNIT 2 MEDIA UNIT 3 SERVICE VOLUME 8. LEADER GUIDE

UNIT 1 MY SPIRITUAL LIFE UNIT 2 MEDIA UNIT 3 SERVICE VOLUME 8. LEADER GUIDE UNIT 1 MY SPIRITUAL LIFE UNIT 2 MEDIA UNIT 3 SERVICE VOLUME 8. LEADER GUIDE faith. life. together. VOLUME 8 2013 LifeWay Press No part of this work may be reproduced or transmitted in any form or by any

More information

TEN TRAITS OF I-AMNESS

TEN TRAITS OF I-AMNESS TEN TRAITS OF I-AMNESS Our feeling of wellbeing, our willingness to embrace life, our hunger for living fully and with joy, our capacity to love and give, our access to deep compassion for ourselves and

More information

Loving God and Others: The Heart of True Faith

Loving God and Others: The Heart of True Faith Loving God and Others: The Heart of True Faith Kay Arthur, David & BJ Lawson PRECEPT MINISTRIES INTERNATIONAL LOVING GOD AND OTHERS: THE HEART OF TRUE FAITH PUBLISHED BY WATERBROOK PRESS 12265 Oracle Boulevard,

More information

T h e BEST BIBLE VERSES. on P R AY E R T R O Y S C H M I D T

T h e BEST BIBLE VERSES. on P R AY E R T R O Y S C H M I D T T h e 100 BEST BIBLE VERSES on P R AY E R T R O Y S C H M I D T 5 2016 by Troy Schmidt Published by Bethany House Publishers 11400 Hampshire Avenue South Bloomington, Minnesota 55438 www.bethanyhouse.com

More information

RUNNING FROM THE HEART JEANNIE LONG

RUNNING FROM THE HEART JEANNIE LONG RUNNING FROM THE HEART JEANNIE LONG Copyright 2017 by Jeannie Long. ISBN: Hardcover 978-1-5434-5313-3 Softcover 978-1-5434-5312-6 ebook 978-1-5434-5311-9 All rights reserved. No part of this book may be

More information

FINDING 5 Awakenings to Your New Life YOUR WAY BACK TO GOD DAVE FERGUSON & JON FERGUSON SESSION 5

FINDING 5 Awakenings to Your New Life YOUR WAY BACK TO GOD DAVE FERGUSON & JON FERGUSON SESSION 5 P A R T I C I P A N T S G U I D E FINDING 5 Awakenings to Your New Life YOUR WAY BACK TO GOD DAVE FERGUSON & JON FERGUSON SESSION 5 NOTE - This Material Is Copyright Protected. This preview copy of the

More information

NOOMA Sunday 004 Rob Bell

NOOMA Sunday 004 Rob Bell NOOMA Sunday 004 Rob Bell NOOMA Sunday 004 Rob Bell Copyright 2005 by Flannel, P.O. Box 3228, Grand Rapids, MI 49501-3228, USA. Published by Zondervan, 5300 Patterson Avenue SE, Grand Rapids, MI 49530,

More information

Words of Life Daily Devotional A SEASON OF GRIEF. Stephanie M. White Kathleen Higham

Words of Life Daily Devotional A SEASON OF GRIEF. Stephanie M. White Kathleen Higham Words of Life Daily Devotional A SEASON OF GRIEF Stephanie M. White Kathleen Higham Copyright 2012 by Stephanie M. White Kathleen Higham Cover design: Stephanie M. White Photograph credit: Kathleen Higham

More information

Bible Road Trip Year One Week Six Exodus ~ Part One

Bible Road Trip Year One Week Six Exodus ~ Part One Bible Road Trip Year One Week Six Exodus ~ Part One Terms of Service Any use of Bible Road Trip constitutes knowledge of, and agreement with, the copyright below. Bible Road Trip is free to individuals

More information

TEN WORDS, TWO SIGNS, ONE PRAYER

TEN WORDS, TWO SIGNS, ONE PRAYER TEN WORDS, TWO SIGNS, ONE PRAYER Core Practices of the Christian Faith Timothy C Tenncnt seedbed Copyright 2013 by Seedbed Publishing All rights reserved. No portion of this book may be reproduced, stored

More information

SAMPLE - COPYRIGHTED MATERIAL SAMPLE - COPYRIGHTED MATERIAL PARISH LEADERSHIP TEAM MANUAL

SAMPLE - COPYRIGHTED MATERIAL SAMPLE - COPYRIGHTED MATERIAL PARISH LEADERSHIP TEAM MANUAL PARISH LEADERSHIP TEAM MANUAL ACKNOWLEDGEMENTS AUTHOR n Rev. Kenneth Boyack, CSP Fr. Kenneth Boyack, CSP, serves as the Vice President of Paulist Evangelization Ministries. The author or editor of fifteen

More information

PREPARING FOR VICTORY WEEKEND

PREPARING FOR VICTORY WEEKEND PREPARING FOR VICTORY WEEKEND PREPARING FOR VICTORY WEEKEND Establish in the Faith PREPARING FOR VICTORY WEEKEND 2004-2017 by Steve Murrell All rights reserved. Published by Every Nation Churches & Ministries

More information

1. What is the best practical advice you have ever received? Who gave you this advice?

1. What is the best practical advice you have ever received? Who gave you this advice? Exodus 18 and 19 April 5, 2017 1. What is the best practical advice you have ever received? Who gave you this advice? 2. Read Exodus 18:1-6 along with Exodus 2:16-22 and 3:1. Describe Jethro. Why do you

More information

Firm Foundations Creation to Christ

Firm Foundations Creation to Christ Firm Foundations Creation to Christ Christian Education Edition Student Guide Part 2 The Truth about God for Fifth and Sixth Graders Developed and Written by Jan L. Harris Based on Firm Foundations: Creation

More information

English Standard Version. Joshua. Conquering Your Enemies Precept Ministries International i

English Standard Version. Joshua. Conquering Your Enemies Precept Ministries International i English Standard Version Joshua Conquering Your Enemies 2017 Precept Ministries International i In & Out English Standard Version JOSHUA CONQUERING YOUR ENEMIES ISBN 978-1-62119-639-6 2017 Precept Ministries

More information

Copyrighted material

Copyrighted material Scripture quotations are taken from the New King James Version. Copyright 1982 by Thomas Nelson, Inc. Used by permission. All rights reserved. Cover by Harvest House Publishers, Inc., Eugene, Oregon Cover

More information

Old Covenant vs. New Covenant

Old Covenant vs. New Covenant Sunday Worship Service October 8, 2017 Rev. YoungMin Kim Old Covenant vs. New Covenant (1) I used to entice my son to do something or to be improved by providing proper rewards. For example, if he had

More information

Copyrighted material Face-to-Face with a Holy God.indd 1 7/21/08 2:11:31 PM

Copyrighted material Face-to-Face with a Holy God.indd 1 7/21/08 2:11:31 PM All Scripture references are taken from the New American Standard Bible, 1960, 1962, 1963, 1968, 1971, 1972, 1973, 1975, 1977, 1995 by The Lockman Foundation. Used by permission. (www.lockman.org) Cover

More information

English Standard Version. Hebrews PART 2 JESUS, OUR HIGH PRIEST FOREVER

English Standard Version. Hebrews PART 2 JESUS, OUR HIGH PRIEST FOREVER English Standard Version Hebrews PART 2 JESUS, OUR HIGH PRIEST FOREVER i In & Out English Standard Version HEBREWS Part 2 Jesus, Our high priest forever ISBN 978-1-62119-089-9 2014 Precept Ministries International.

More information

Spiritual Warfare: Overcoming the Enemy

Spiritual Warfare: Overcoming the Enemy Spiritual Warfare: Overcoming the Enemy Kay Arthur, David & BJ Lawson PRECEPT MINISTRIES INTERNATIONAL Excerpted from Spiritual Warfare: Overcoming the Enemy by Kay Arthur, David & BJ Lawson Copyright

More information

Weekly Overview. Welcome To Bible Study The Circle Maker: Praying Circles Around Your Biggest Dreams and Greatest Fears 5/18/2016

Weekly Overview. Welcome To Bible Study The Circle Maker: Praying Circles Around Your Biggest Dreams and Greatest Fears 5/18/2016 Welcome To Bible Study The Circle Maker: Praying Circles Around Your Biggest Dreams and Greatest Fears Weekly Overview Schedule Week 1 Whole Group (I) Week 2 Whole Group Week 3 Small Group Week 4 Whole

More information

FINDING 5 Awakenings to Your New Life YOUR WAY BACK TO GOD DAVE FERGUSON & JON FERGUSON SESSION 2

FINDING 5 Awakenings to Your New Life YOUR WAY BACK TO GOD DAVE FERGUSON & JON FERGUSON SESSION 2 P A R T I C I P A N T S G U I D E FINDING 5 Awakenings to Your New Life YOUR WAY BACK TO GOD DAVE FERGUSON & JON FERGUSON SESSION 2 NOTE - This Material Is Copyright Protected. This preview copy of the

More information

Bible Road Trip Year Two Week Two

Bible Road Trip Year Two Week Two Bible Road Trip Year Two Week Two Exploring the Old Testament Terms of Service Any use of Bible Road Trip constitutes knowledge of, and agreement with, the copyright below. Bible Road Trip is free to individuals

More information

Loving God and Others: The Heart of True Faith

Loving God and Others: The Heart of True Faith Loving God and Others: The Heart of True Faith Kay Arthur, David & BJ Lawson PRECEPT MINISTRIES INTERNATIONAL LOVING GOD AND OTHERS: THE HEART OF TRUE FAITH PUBLISHED BY WATERBROOK PRESS 12265 Oracle Boulevard,

More information

International Bible Lesson Commentary below. Exodus 40:16-31, 34, 38 International Bible Lessons Sunday, November 24, 2013 L.G. Parkhurst, Jr.

International Bible Lesson Commentary below. Exodus 40:16-31, 34, 38 International Bible Lessons Sunday, November 24, 2013 L.G. Parkhurst, Jr. International Bible Lesson Commentary Exodus 40:16-31, 34, 38 International Bible Lessons Sunday, November 24, 2013 L.G. Parkhurst, Jr. The International Bible Lesson (Uniform Sunday School Lessons Series)

More information

Home/Mentor Guide. My heart I offer you, Lord, promptly and sincerely. John Calvin

Home/Mentor Guide. My heart I offer you, Lord, promptly and sincerely. John Calvin HOME/ MENTOR GUIDE Home/Mentor Guide My heart I offer you, Lord, promptly and sincerely. John Calvin 2018 Geneva Press First edition Published by Geneva Press Louisville, Kentucky All rights reserved.

More information

Revelation: Verse by Verse Session 68 Revelation 12:1-4 A Woman, a Child, and a Great Red Dragon, Part 1 SESSION 68 REVELATION 12:1-4

Revelation: Verse by Verse Session 68 Revelation 12:1-4 A Woman, a Child, and a Great Red Dragon, Part 1 SESSION 68 REVELATION 12:1-4 SESSION 68 REVELATION 12:1-4 332 REVIEW - Revelation 6-19 Times Through the. 1st time The OPENING of. (6:1-8:1) 2nd time The SOUNDING of. (8:2-11:19) 3rd time The REVEALING of. (12-14) 4th time The POURING

More information

NOOMA Store 016 Rob Bell

NOOMA Store 016 Rob Bell NOOMA Store 016 Rob Bell NOOMA Copyright 2007 by Flannel, P.O. Box 3228, Grand Rapids, MI 49501-3228, USA. Published by Zondervan, 5300 Patterson Avenue SE, Grand Rapids, MI 49530, USA. Scripture quotations

More information

Book 4. A helpful guide to teaching God s Word with clarity, authority and care. Children s Edition FOUNDATIONS

Book 4. A helpful guide to teaching God s Word with clarity, authority and care. Children s Edition FOUNDATIONS LESSONS 26-38 THE TABERNACLE JESUS BIRTH AND MINISTRY Book 4 Children s Edition A helpful guide to teaching God s Word with clarity, authority and care. FOUNDATIONS Firm Foundations Creation to Christ

More information

Meeting the Father of Lights in the Midst of Our Darkness. An In-Depth Interactive Study. Cathy Deddo

Meeting the Father of Lights in the Midst of Our Darkness. An In-Depth Interactive Study. Cathy Deddo The Letter of James Meeting the Father of Lights in the Midst of Our Darkness An In-Depth Interactive Study Cathy Deddo James.indb 3 Website: www.trinitystudycenter.com Email: theletterofjamesstudy@gmail.com

More information

QK000_Layout 1 7/6/11 2:10 PM Page 1 THE JOURNEY. Walking the Road to Bethlehem. Youth Edition

QK000_Layout 1 7/6/11 2:10 PM Page 1 THE JOURNEY. Walking the Road to Bethlehem. Youth Edition QK000_Layout 1 7/6/11 2:10 PM Page 1 THE JOURNEY Walking the Road to Bethlehem Youth Edition QK000_Layout 1 7/6/11 2:10 PM Page 2 QK000_Layout 1 7/6/11 2:10 PM Page 3 THE JOURNEY Walking the Road to Bethlehem

More information

To: From: God s activity is far greater than anything we could aspire to do for Him. Henry Blackaby

To: From: God s activity is far greater than anything we could aspire to do for Him. Henry Blackaby To: From: God s activity is far greater than anything we could aspire to do for Him. Henry Blackaby 2007 LifeWay Press Third printing 2012 No part of this book may be reproduced or transmitted in any form

More information

Feast of Tabernacles 2008

Feast of Tabernacles 2008 Feast of Tabernacles 2008 The Law shall go forth from ZION. Coloring Book My Name: Written & Illustrated by: Don & Bonnie Burrows Scripture references based on: The Holy Bible in its Original Order 2009

More information

Teacher s Guide. My heart I offer you, Lord, promptly and sincerely. John Calvin

Teacher s Guide. My heart I offer you, Lord, promptly and sincerely. John Calvin TEACHER S GUIDE Teacher s Guide My heart I offer you, Lord, promptly and sincerely. John Calvin 2018 Geneva Press First edition Published by Geneva Press Louisville, Kentucky All rights reserved. No part

More information