Lesson 8 James 4:6-17

Similar documents
MEMORY VERSE: Draw nigh to God, and he will draw nigh to you (James 4:8)

December 22 READ JAMES 4 5. CHAPTER 4 FROM whence come wars and

With Submission Believers are to be committed to living out God s will.

The Danger Of Following The Philosophy Of Our Society That Is Destructive

THE PEOPLE OF GOD ARE CALLED TO SET ASIDE WORLDLY VALUES AND SELFISH AMBTIONS IN ORDER TO LIVE A LIFE OF FAITHFUL HUMILITY BEFORE THE LORD.

Session 12 With Submission James 4:6-17 November 17-18, 2018

9 Be afflicted, and mourn, and weep: let your laughter be turned to mourning, and your joy to heaviness.

HINDRANCES TO THE CHRISTIANS PRAYERS #1.

James 4 Overcoming the Flesh

Pride Promotes Strife (4:1-6)

God's Grace to the Humble - Part 2

Adult Sunday School Lesson Summary for August 24, 2008 Released on Wednesday, August 20, "Godly Behavior"

God s Grace to the Humble Part 1

A Disciples Heart. Humility

Book of James James 4

A PRAYER OF SURRENDER

A Prayer of Surrender

... SuBMIT TO Gon IN LovE. Key Verse: Draw near to God, and he will draw near to you. ]ames 4:8 (NRSV) JAMES 4:1-10 (KJV) JAMES 4:1-10 (NRSV)

Hey, Don t Forget To Include God In Your Plans

Behind the Book Authentic Christianity James 4:7-10 July 11, 2018

James. (Includes Doers of the Word, Our Words, from the Old Testament, and Our Words, from the New Testament. ) Eight Lessons (Verse-by-Verse)

Humbling Ourselves James 4

Valley Bible Church Sermon Transcript

Humility Bible Study November Always be Humble

52 Week Bible Verse Challenge Weekly Verses

Conflict Why Can t We All Just Get Along?

Crucify The flesh. 1Th 4:7 For God hath not called us unto uncleanness, but unto holiness.

James. Participants Guide. Do not merely listen to the word, and so deceive yourselves. Do what it says. James 1:22

James. Week 16 James 4:7-10

A PRAYER OF SURRENDER

Portfolio Poison! James 5:1-7a

Luke 5:32 I have not come to call the righteous, but sinners, to repentance.

52 Week Bible Verse Challenge Weekly Verses

Neither is there salvation in any other: for there is none other name under heaven given among men, whereby we must be saved.

faith, hope, love James 4:1-17 Protecting Your Faith We live in a hazardous world. Daily doses from the media Inductive Discovery Lesson 6

SESSION POINT WHAT IDEAS OR IMAGES COME TO MIND WHEN YOU HEAR THE WORD SURRENDER? APPROACH PRAYER WITH HUMBLE SUBMISSION TO THE WILL OF GOD.

receive the crown of life, which the Lord hath promised to them that love him.

Present-Day Speaking Come, Says the Lord

Repentance part 3; Attitude

Robert Baral**EPISTLES**essay - Faith and Good Works in JAMES**12/14/2005 AD**page 1 ON FAITH AND GOOD WORKS IN THE BOOK OF JAMES

Easy to Be Entreated

With Submission Believers are to be committed to living out God s will.

James 4:7 10 THEME GOD WANTS OUR SINCERE OBEDIENCE. James 4:7, Submit yourselves, then, to God

JAMES: A GLC BOOK STUDY SESSION 4: FAITH THAT WORKS NAME CONTACT INFO: Ptr. Jonathan Bradford

The War Within. James 4:1-12

Sunday Judgment Or Discernment James 4:11; Matthew 7:1-5; John 7:24

Scripture Worksheets

James 4:1-10. James 4:1: "From whence come wars and fightings among you? come they not hence, even of your lusts that war in your members?

CHALLENGE FOR THE NEW YEAR HAVING HEAVENLY MINDED AFFECTIONS

Ricany, CZ SERMON OUTLINE 10/27/2013. Daniel 3:1-30 The God Who Rescues

Living Out My Faith In Jesus - James Week #7

I Was Wrong and I m Sorry

James 4:11, Brothers, do not slander one another. Anyone who speaks against his brother or judges him speaks against the law and judges it.

CRY OUT TODAY FOR GOD S KNOWLEDGE, WISDOM & UNDERSTANDING

The Heart of the Matter

JAMES 1. Trust Jesus He Cares Visit to download a free chapter by chapter quiz of the entire bible.

January 2011 Solemn Assembly

Romans 12:2 Staying on the altar

FIVE LIES THAT RUIN RELATIONSHIPS

DRAW NIGH TO GOD JAMES 4:1-7

Ideas for the Iowa District West

Welcome to. Rehoboth New Life Center Sunday August 27 th 2017

Explore the Bible Lesson Preview November 18, 2018 With Submission Background: James 3:13-4:17 Lesson: James 4:6-17

Week 6 - Teaching 006.p01

James: Proverbs of the New Testament. James: Proverbs of the New Testament

3. Hag. 1:7 Thus says the LORD of hosts: Consider your ways!

Sermon : How To Draw Near To God ( Pt 2) Page 1

Scripture Worksheets

FIRST BAPTIST RAYTOWN

Gospel-Centered Living #8 Humility. James 3-43

Finding Wisdom In Our Lives!

Twenty-One Days of Fasting and Praying

T h e E p i s t l e o f J a m e s

Warnings and Encouragement Sermons From Pastoral Rule, Book 3 July 17, 2016

James 4:1-10 The Cause and Cure of Conflict among Brethren

In 2 Corinthians 12:20, Paul ends his second letter with

HOW TO BE A GOOD AND PROFITABLE SERVANT SOWING THE WORD OF GOD MONDAY, JULY 11, 2016

Faith in Real Life James 4:1-10 Faith in War

The Biblical Keys to Answered Prayer

THREE DAYS. A. YOU DON'T KNOW WHEN IT IS. ISAAC GEN 27:2 And he said, Behold now, I am old, I know not the day of my death:

Sunday Morning. Study 9. If the Lord Wills...

Fulfilling the Conditions for Revival

Marks of an Authentic Disciple (Part 1) (Luke 6:20-23)

These spiritual poisons will hinder the transforming work of the Holy Spirit in you.

James 4:7-10 Submit, Resist, Draw Near, Cleanse, Lament, and Humble Yourselves

2 Corinthians 2:1-11 Satan s Deceiving Devices

A Study Of The Book Of JAMES

A Study Of The Book Of JAMES

Imitating Christ s Humility

11/25/12 James 4: Humility

Bible Interpretation. What does the Bible Mean

OBEDIENCE TO GOD Luke 5:1-11

Exodus 33:13. Genesis 50:20. Joshua 1:8. Exodus 33:19. Joshua 1:9. Joshua 3:7. Joshua 10:25. Joshua 10:42

Context not Pretext. a reason given in justification of a course of action that is not the real reason:

Chico Alliance Church October 8, 2017 Pastor David Welch Jonah Series #5. Repentance

Sunday Morning Message December 16, 2018 Christmas Message A Christmas Mindset Text Philippians 2:1-11 Congregational Reading Philippians 2:5-7

4:1 What is the source of quarrels and conflicts among you? Is not the source your pleasures that wage war in your members?

In This Study. Humility. Humility. Humility. Humility. Qualities of a pure heart

SECURITY OF THE BELIEVER

Introduction. A. The Sermon on The Mount. B. The context

Transcription:

Lesson 8 James 4:6-17 Verse 6: But he giveth more grace. Wherefore he saith, God resisteth the proud, but giveth grace unto the humble. Theinterpretationwegivetoverse5willdeterminethemeaningofthecontrastwe findinthefirsthalfofverse6 buthegivesmoregrace. Ifverse5istakenasastatementaboutthesinfulnessofthehumanspirit,thenthis greater grace suggests the willingness and ability of God to overcome that sinfulness.asphillipstranslatesit,hegivesusgracepotentenoughtomeetthisand anyotherevilspirit. If,however,verse5isdepictingthejealousyofGodforus,thenthecontrastinverse 6 emphasizes that God's grace is completely adequate to meet the requirements imposedonusbythatjealousy. OurGodisaconsumingfire,andhisdemandsonusmayseemterrifyingat times,butourgodisalsomercifulandgraciousandloving,andhewillingly suppliesallthatweneedtomeethisdemands.asaugustinesaid,godgives whathedemands. There is, however, a requirement for the experience of this grace and that is humility. JamestellsusthiswithaquotefromProverbs3:34 Godresiststheproud, butgivesgracetothehumble. God'sgiftofsustaininggracecanbereceivedonlybythosewillingtoadmit theirneedforthatgraceandacceptthatgift.theproud,bycontrast,meet only resistance from God, and that of course is a theme that sounds loudly throughouttheoldtestament. Anditisworthnotingthatsuchprideisveryoftenassociatedwithjealousy ofthesortwehaveseenhereinjames. Augustine:"IfyouaskmewhatisthefirstpreceptoftheChristianreligion,I willanswerfirst,second,andthird,humility." 7 Submit yourselves therefore to God. Resist the devil, and he will flee from you. Page 1 of 15 www.thywordistruth.com

ThatquotefromProverbsleadsusintoverses7 10.Infact,thecommandsinverses 7 10 flow from that quotation from Proverbs. If God indeed gives grace to the humble,thenclearlywemustsubmittogod This command to submit to God acts like a heading for the following series of commandsinverses7 10,anditismatchedinverse10bythecommandtohumble yourself. BetweenthosetwofundamentalcommandstosubmittoGodandtohumble yourself,therearethreepairsofcommands:(1)resistthedevil drawnear togod,(2)cleanseyourhands purifyyourhearts,and(3)bewretched letyourlaughterbeturnedtomourning. Thecontextherestartingwithverse6isverysimilartowhatwefindin1Peter5:5 9, where we also find a quotation from Proverbs 3:34 followed by a series of commands, including a command to humble yourself so that in due time God may exaltyou.peteralsotellsustheretoresistthedevil.(seethewebsitefornoteson1 and2peter.) The New Testament writers understood that Satan is real and must be actively resisted,andtheyunderstoodthathumanprideprovidestheeasiestroadforsatan tomoveintosomeone'slife. Back in Chapter 1, James stressed the individual's own evil tendency to sin. (See 1:14,forexample.)Buthere,JamesrecognizestherolethatSatanplays. WeareremindedofSatan'stemptationofEveintheGarden eachhadarole toplayinthatfirstsinandeachboreresponsibility. WemustneverforgetthatSatan'spurposeistoseparateGodandman,and that he is viciously opposed to the message of reconciliation in Jesus Christ that would undo that separation. It is this separation that Christians must activelyresist,bothintheirownlivesandinthelivesofothers. WhenweresistSatan,wereceiveapromise. Jamestellsusthatthedevilwillthenfleefromus.Notjustbackawayorturn aside, but flee! Whatever power Satan may have, the Christian can be absolutelycertainthathecanbedefeatedandmadetoflee notbecauseof our own power, but because of the power of Jesus Christ who has already defeatedsatan. TheGospelsandActsarefilledwithexamplesofSatanandhiscohortsfleeing beforedivineauthority. Luther:"IfwesingPsalmsandhymnsorreadScriptures,Satanwillfleefrom uslesthescorchhiswings." Page 2 of 15 www.thywordistruth.com

InsteadofallowingSatantoseparateusfromGod,wemustmakecertainthatjust theoppositeistrue. We must draw near to God. Satan may be running away, but that doesn't mean we should then stand around like we did it ourselves. We must be humbleanddrawneartogod,whowillbewaitingforusasthefatherwaited fortheprodigalson. God'sgrace,asJamestellsus,pointstoourownresponsibility,and,infact,inverses 7 10therearenolessthan10commandstoobey. James does not see the inexhaustible supply of God's grace as sweeping us alongtosomesortofeffortlessholiness.heknowsofnosucheasyvictory. The benefits of grace and more grace are ours along the road of obedience andmoreobedience. The God who says here is my grace to receive also says here are my commandstoobey.faith,wisdom,grace noneofitcanbedivorcedfrom obedience. In verse 7, James describes this humble walk with God by commanding active allegiance. Christiansmusthavenodoubtintheirmindswhosesidetheyareon,andby theirlivestheymustleavenodoubtinthemindsofothersthattheyareon God'ssideandunyieldingopponentsofSatan. TheEnglishtranslation"submit"doesnotreallydofulljusticetotheGreek. When we think of submission we think of that point at which the struggle endsandpassivitybegins.butthegreekwordthatjamesusesismuchmore of an enlistment word the taking up of allegiance to a great superior in order to engage in the fight under his banner. The word speaks of a subordinate's readiness to await commands and to do the will of the superior. If the translation "submit" is too passive, then the translation "resist" if anythingistooactive.inthegreek,itisnotawordforonewhoiscarrying the attack over into the enemy's camp, but rather refers to one who is manning the defenses knowing that he is constantly under fire from the enemy. 8 Draw nigh to God, and he will draw nigh to you. Cleanse your hands, ye sinners; and purify your hearts, ye double minded. 9 Be afflicted, and mourn, and weep: let your laughter be turned to mourning, and your joy to heaviness. Page 3 of 15 www.thywordistruth.com

Inverse8,JamesspellsoutwhatitmeanstodrawneartoGod.Doingsocallsfora sincereandradicalrepentancefromthebehaviorsthatjameshasbeendescribing. Søren Kierkegaard, the Danish theologian/philosopher, saw double mindedness as theessentialdiseaseofthehumanheart. HisbookPurityofHeartIstoWillOneThingisameditationonthestatement from James: Purify your hearts, you double minded (James 4:8). The diseasediagnosedbykierkegaardisthefailuretohavealifethatisfocused on one thing. It is the failure to make an ultimate commitment to what Kierkegaard calls the Good what Jesus spoke of as seeking first the kingdomofgod (Matthew6:33). One commentator notes the "blunt vividness" that James displays with Greek he usesinverse8. Sinners, men of double mind. And in fact, this does create a contrast with James'familiarandaffectionateaddress,"brethren."Jamesisveryconcerned abouttheseriousnessofthesituationheisnotaddressing,andhewantshis readerstounderstandandappreciatethatconcern. "Menofdoublemind"isfromaGreekwordthatliterallymeans"twosouled." WehaveseenthisthemethroughoutthebookofJames,andinfactitcouldbe arguedthatthisis"thetheme"ofjames.inchapter1,jamesdescribedsuch apersonasonewhosefaithismarkedbydoubtingandinstability.heusedit justafewversesagotodenotethemindofdoublenessinapersonwhoseeks tobefriendoftheworldandafriendofgod. Godandtheworld.ThekingdomofGodandthekingdomofSatan.Theagetocome andourownevilage.thechristianisbeingpulledandtornbetweenthem. Toallowtheworldtoenticeusawayfromatotalsingle mindedallegianceto God is to become people who are divided in their loyalties, people who are double minded,peoplewhoarespirituallyunstable,peoplewhoareuseless togod. IfweeverbecomeineffectiveinthekingdomofGod,Jamesistellingushere abouttherootcauseofthatineffectiveness ourdividedloyalty,ourlackof spiritual focus, our flirtation with the world, our failure to be true hearted andwhole hearted. What is required of such double minded people is a repentance both from this externalbehavior(cleanseyourhands)butalsofromtheinternalattitudethathas ledthemtothatbehavior(purifyyourhearts). Page 4 of 15 www.thywordistruth.com

The Psalmist in Psalm 24:3 4 said that clean hands and a pure heart are requiredofthosewhowouldstandbeforethelord. Weareremindedofabeatitude:Blessedarethepureinheart,fortheyshall seegod. (Note that once again we see one of Jesus beatitudes shining through from thepagesofjames letter.ifiwereevertopenacommentaryonthisbook,i believeiwouldtryandtakethatrepeatedcomparisonasmytheme.) In verse 8, James continues his description of the humble walk with God by commanding us to draw near to God. And we are encouraged to obey it by the promisethatgoesalongwithit thathewillthendrawneartous. Butofcoursewewouldtendtoreversethatorder.Howeasyitwouldbeto enjoyadailytimewithgodifonlywehadtobeginwithamorevividsenseof hispresence.ifhewouldonlydrawneartous,thenwecoulddrawnearto him.wewantthepromisetocomebeforethecommand,butthatisnotwhat James says at all. God enriches with his presence those who obey the commandtoseekhispresence. Jamesisnotjustgivingsomehaphazardandunrelatedlistofcommandshere.Heis settingthemdownforusinanorderedpathwayofobedience. ThefirstthingwemustdoislivenearGod,andthatinvolvesthedisciplines of regular Bible reading, and prayer, and worship, and communion, and Christianfellowship,etc. FellowshipwithGodandtheconsequentblessingofhisfellowshipwithusdo notjusthappen.wecan'tdriftintoitanymorethanwecanjustdriftinto holiness. It is something we must obey, something we must do. Christian peoplearedeliberatepeople;theydon'tdriftanywhere. Wearealsocommandedtopurifyourlivesinverse8. Wearetoldtocleanuptheouterlifeofthehandsandtheinnerlifeofour heart. And note the use of the verb here we are to purify ourselves and cleanseourselves,notbepurifiedandbecleansed.theverbsareactive,not passive. Of course, the purification comes from the blood of Christ, but we haveavitalroletoplayinthatprocess. Wearecommandedtocleanupourconductandcleanupourhearts. Butagain,wemustkeepthiscommandintheproperplaceinthesequence. Logic might suggest that we should first clean up our lives and then draw neartogod.jamessaysotherwise.itiswhenwedrawneartogodthatwe Page 5 of 15 www.thywordistruth.com

are at last in a position to face the demands of holiness and find ourselves motivatedbythedesiretobeholyasheisholy. Inthiswaywearepreparedforthecommandinverse9tolamentoursinandto repentofit. And perhaps surprisingly, as we follow the sequence we see that this awarenessofourownwretchednessisthegoaloftheprogram. The decisive taking of sides in verse 7 leads us to draw near to God, which thenpromptsinusalongingtobelikehiminhisholiness,andaswework towardthatgoalthemoreweseeourownsinsandshortcomings.butgod setsthedownwardpathbeforeusbecausethereisnootherwayup. Paulknewthatthepathupbeginsasapathdown.SeeRomans7:24 25. O wretchedmanthatiam!whoshalldelivermefromthebodyofthisdeath?i thankgodthroughjesuschristourlord. Theseverecommandsofverse9echothelanguageoftheprophets. They often used the language of mourning to describe the disasters that accompaniedthejudgmentsofgod.buttheyalsousedthatlanguagetocall God'speopletorepentfromsin. Thus,Joel,warningofthenearnessofthedayoftheLord,picturesin2:12the Lord inviting his people to return to him with all their heart, with fasting, withweeping,andwithmourning.jamesusesthatlanguagehereinthesame sense. Jamesisdemandingadeep,heart feltsorrowforsin,whichisamarkoftrue repentance. It is what Paul called in 2 Corinthians 7:10, a Godly grief that leadstosalvationandbringsnoregret. ThisisalsohowwearetounderstandJames'commandthatlaughterbeturnedto mourningandjoytodejection. James is certainly no killjoy denying any place for laughter and joy in the Christian life. (No brother of Jesus could ever be such a person!) But laughter in the Old Testament is often the scornful laughter of a fool who refuses to take sin seriously, and we hear that same laughter all around us todayamongthosewholiveandprosperinthisworldwithoutanyregardfor theworldtocome. ItistothisgroupthatJesussaid,"Woetoyouthatlaughnow,foryoushall mourn and weep." (Luke 6:25) What men will do when God's judgment overtakesthemcanbeavoidediftheymournandweepforsinnow.atsome Page 6 of 15 www.thywordistruth.com

pointeveryonewillmournandweepforthesinintheirlife,butformostthat daywillcometoolate. Again,weareremindedofabeatitude,Matthew5:4,"blessedarethosewho mourn,fortheyshallbecomforted." Most people today are marked by a superficial joy. They live under the hedonist banner eat, drink, and be merry, for tomorrow we die. They ignoretheworldtocome.andchristians,also,canslipintoacasualattitude toward sin, perhaps presuming too much on God's forgiving and merciful nature.godisnotmocked! True Christian joy comes from true Christian repentance, and that is what Jamesistellingushere.Thatkindofrealjoyisajoythatoverflowsfroma knowledgeandconsciousnessthatoursinshavebeenforgiven. 10 Humble yourselves in the sight of the Lord, and he shall lift you up. Jamesconcludeshisseriesofcommandswiththesummarizingcommandtohumble yourself. TohumbleourselfbeforeGodmeanstorecognizeourownspiritualpoverty, toacknowledgeourdesperateneedforgod'shelp,andtosubmittohiswill withwhole hearteddevotion. ItisthistypeofhumilitythatwasshownbythetaxcollectorinJesus'parable who, deeply conscious of his own sin, called out to God for mercy. In response, Jesus said in Luke 18:14, everyone who exalts himself will be humbled,buthewhohumbleshimselfwillbeexalted. 11 Speak not evil one of another, brethren. He that speaketh evil of his brother, and judgeth his brother, speaketh evil of the law, and judgeth the law: but if thou judge the law, thou art not a doer of the law, but a judge. 12 There is one lawgiver, who is able to save and to destroy: who art thou that judgest another? Inverses11 12,Jamesonceagaindiscussesproblemsassociatedwiththetongue. Somecommentatorsarguethattheconnectionbetweentheseversesandits immediate context is not clear. Perhaps it is simply that speaking evil of others is a clear manifestation of the sinful pride that James has been addressing.butspeakingevilofothersisalsooftenlinkedwithjealousyand envy and is a manifestation of double mindedness, which also fit into the contexthere. Page 7 of 15 www.thywordistruth.com

David linked slander with a lack of humility in Psalm 101:5. ( Whoever slandershisneighborsecretlyiwilldestroy.whoeverhasahaughtylook andanarrogantheartiwillnotendure. ) Inverse11,aftertheharshtoneinverse8,Jamesonceagainaddresseshisreaders asbrethren.thegreekwordusedherefor speaknotevil literallymeans"tospeak against." It would include many types of harmful speech, such as questioning legitimateauthoritywhenthepeoplespokeagainstgodandagainstmosesin Numbers 21:5, or slandering someone in secret as in Psalm 101:5, or bringingfalseaccusationsasin1peter2:12and3:16.perhapsthedisputes inthechurchthatjameshasbeenaddressingprovidedthecontextforthese personalattacksandslanderousaccusations. The Rabbis referred to slander as the third tongue because it has three victims:thespeaker,theonespokento,andtheonespokenabout. ThejustificationthatJamesprovidesforhisprohibitionoftheseslanderousattacks ininteresting. Hesaysthattospeakagainstortojudgeone'sbrotheristospeakagainstfor to judge the law. Which law does James mean? He could mean the Old Testament to which he has been directly and indirectly alluding to throughout his letter. But since James 2:8 tells us that James likely has anotherlawinmindhere theroyallawofchrist. Howisitthatjudgingorspeakingillofafellowbelieverjudgesorspeaksillofthe law? SinceJamescontrastsjudgingthelawwithdoingthelaw,heistellingusthat afailuretodothelawinvolvesanimplicitdenialofthelaw'sauthority. However high and orthodox our view of God's law may claim to be, our failuretodoitsaystotheworldthatwedonotinfactputmuchstorebyit. Again,weseeathemeofthisbookthatourfaithfulnesstoGodistestedby ourobediencetogod,andabsentobedience,faithisdead. Verse12tellsusthatspeakingeviloffellowChristiansiswrong,notonlybecauseit involvesjudgingthelaw,butalsobecauseitinvolvesjudgingtheneighbor. Andsuchcriticismnotonlydisobeysthecommandthatwelovetheneighbor, but also displays an arrogant presumption on the rights of God himself becausegodistheonelawgiverandtheonejudge. Page 8 of 15 www.thywordistruth.com

We in effect set ourselves up to be in his place, which perhaps is the underlyingcauseofallsin ourdesiretobeintheplaceofgod.inanyevent, thatistheveryissuewithwhichjameswillcloseoutchapter4. Ofcourse,thereisaproperandnecessarykindofjudgmentanddiscriminationthat everychristianmustexercise. After all, if we cannot make judgments based on whether we or others are obeyingthecommandsofgod,thenhowcanwetakethegospeltothelost and how we can in fact know that we ourselves are saved? How could we exercise discipline within the church absent the ability to make any sort of judgment? James is speaking here of harsh, condemning judgments, and, in particular, suchcriticismsofourfellowchristiansovermattersofopinion.hisconcern waswiththesamekindofviscouspersonalattacksthatwesee,forexample, around us today in the world of politics, and again we are reminded of the politicalpartisantermthatjamesusedtodescribewhatwasgoingon.heis describingyetanotherflirtationwiththeworld. Thecommand"donotspeakevilagainst"couldbetranslated"donotdefame." A defamatory word may be perfectly true, but the fact that it's true doesn't give us a right to say it. It gives us no right to talk down to the person to which it applies to adopt a superior position from which to denigrate or defamethatperson. Defamation is forbidden here not because it is a breach of the truth or a breachoflove,butitisforbiddenherebecauseitisabreachofhumility.if wearereallylowbeforegodthenwehavenoaltitudeleftfromwhichtotalk downtoanyone. TheGreekverbusedhereisfoundelsewhereonlyin1Peter2:12and3:16 where it refers to the dismissive condemnations of the world that were directedagainstchristians. One commentator claims that the Old Testament denounces evil speaking againstgodandagainstothersmoreoftenthananyotheroffense. Jameselaborateshisprohibitionagainstdefamatorytalkalongfourlines.First,he tellsushowweshouldregardeachother. He tells us we are brothers and neighbors. This relationship puts us all on thesamelevel.noneofusisthefirstborn.(romans8:29) The reference to God as the lawgiver and the one who could condemn or destroyisareminderthatgodchosetosaveratherthantocondemn,andhe Page 9 of 15 www.thywordistruth.com

didsowhilewewereyetenemies.thatistheexamplewemustfollowwhen wearetemptedtohurlcondemningspeechatsomeone. Asforneighborliness,Jesus'definitionofthetermintheparableoftheGood Samaritan in Luke 10 leaves no room for talking down but rather for reachingdown. "If I know something that is to the discredit of a fellow Christian, and be it ever so true, my task is not to publicize it nor even to privately berate him with it, but rather to go where he is and to lift him up. I must be the Samaritantohim.Heismyneighbor." Second,Jamestellsushowweshouldregardthelaw. He told us in 2:8 that God gave us his royal law that we should love our neighbors.whathappensthenwhenwedesertthatpathofloveforthatof criticismanddefamation?verse11sayswespeakevilagainstthelawwhen wespeakevilagainstabrother. First, we break the law by doing that. It commands love, and we respond withdefamation. Second, we set ourselves up as knowing better than the law. We judge the law.ineffect,wesaythatthelawismistakenincommandinglove.itshould ratherhavecommandedcriticism,andifweweretheonelawgiveritwould havedoneso. Third,wetakeanewposition notadoerofthelaw,butajudge.wewantto take on the authority of God himself, and this leads us to James' third observation. Third,JamestellsushowwearetoregardGod. Inverse12,hesaysthereisonelawgiverandonejudge.Whenwedisobey thelaw,whatarewesayingwithregardtothelawgiver?wearedisputing hisauthority,butmorethanthat.hislawistheexpressionofwhoandwhat heis.hegaveushiscommandssothatbyobeyingthemwemightbecome morelikehim.werejectallofthatwhenwemakeourselvesthelawgiver. Finally,Jamestellsushowwearetoregardourselves. "Butwhoareyou?,"heasksinverse12.Ifweexaltourselvesoverabrother, doesn'tthatcallintoquestiontherealityofourwholelifewithgod? Page 10 of 15 www.thywordistruth.com

13 Go to now, ye that say, To day or to morrow we will go into such a city, and continue there a year, and buy and sell, and get gain: 14 Whereas ye know not what shall be on the morrow. For what is your life? It is even a vapour, that appeareth for a little time, and then vanisheth away. 15 For that ye ought to say, If the Lord will, we shall live, and do this, or that. The businessmen that James discusses in the next few verses are shown here as deliberateandself confidentplanners. Theydecidewheretheywillgo,whentheywillgo,howlongtheywillstay, andtheyarecertaintheywillgainprofitfromtheiractivities. AndthepicturethatJamespaintsherewouldbefamiliartohisreaders.The first century was a period of great commercial activity, especially for the HellenisticcitiesofPalestine,whichwereheavilyinvolvedincommerceofall sorts. And today, the picture that James paints is likewise very recognizable, particularly now that commerce encircles the globe. In our time, just as in James'day,thebottomlineisthesame profit. Andwiththatword,profit,weareimmediatelyremindedofJesus'statement inmatthew16:26(forwhatprofitisittoamanifhegainsthewholeworld, andloseshisownsoul?orwhatwillamangiveinexchangeforhissoul?). What we see here is that James' concern is not with someone making a profit. Rather his concern is with the exclusive this world only attitude that characterize the plans that are being made, a danger to which perhaps business people are particularlysusceptible. It is interesting that Christians often use the word "secular" to describe certainoftheiractivitiesasifithasanylegitimateplaceinchristianity.that expressiondenotesactivitiesthathavenoreligiousorspiritualbasis. There are still many people who plan their lives just as James describes. Many young people (and older people as well) plan their education, their work,theirlocation,theirfamily,etc.withnothoughtforgodandforwhat hewouldhavethemdo. ThemerchantsplanandcarryonasifGodwereunimportantordidnotevenexist. Insteadtheyshouldhavemadetheirplansintheprayerandanticipationthat Godmayinfactchangethoseplans.Theyoughttobealerttothenewthing that God may have planned for them and to the opportunities that he provides. But instead they go through their lives with blinders on for fear, perhaps,ofseeingwhatgodwouldhavethemdo. Page 11 of 15 www.thywordistruth.com

In the parable of the Good Samaritan, the priest and the Levite did not so much violate some detailed command but rather they were just so preoccupiedwiththeirownbusinessandtheirownplansthattheyfailedto dogoodwhengiventheopportunity.theywalkedbywithblinderson. In making their plans with reference only to this world, these planners have neglectedtotakeintoaccountafundamentalfact thisworldisinsubstantialand transitory. Forsuchpeopleastheyare,toplansoconfidentlyandseeminglysocarefully, it is the height of foolishness that they have neglected such an important factor. Afterall,Jamestellsus,ourlifeislikeamist.TheGreekwordmeansapuffof smoke, which could be dissipated by the morning sun or blown away by a shiftofthewind.weseethissamewarningthroughouttheoldtestament. Proverbs27:1says, Donotboastabouttomorrow,foryoudonotknowwhat a day may bring forth. Job 7:7, 9, 16 and Psalm 39:5 6 describe life as a breath. Wearealso,onceagain,remindedofJesus'teachingsonthissubject. InLuke12:15hewarnedthecrowdsaboutcovetousnessandthedangerof assumingthatourlifeconsistsonlyofwhatweown.laterinluke12,jesus told the parable about a rich fool who sounds very much like the person James is describing in Chapter 4. That parable must have been in James' mindashepennedtheseverses. Instead of this self confident, this world only attitude, we should instead have an attitudeinwhichwhatwedoandwhatweplantodoarequalifiedbyreferenceto thewillofgod. Paul did this as he frequently expressed his reliance on the will of God regardinghisownplansforhismissionarywork.(acts18:21,romans1:10,1 Corinthians4:19,16:7) However, Paul and the other apostles did not always explicitly state that reliance. What was important was not that they mouth the words "God willing"(whichcaneasilybecomejustaglibandmeaninglessrecitation)but rather that they lives the words "God willing" and adopted it as a guiding principleintheirlivesandintheirplans. Jamesisencouragingsomethingmuchdeeperthanjustwords hewantsus tounderstandgod'scontrolofaffairsandtheutmostimportanceofhiswill forourlives. Page 12 of 15 www.thywordistruth.com

16 But now ye rejoice in your boastings: all such rejoicing is evil. 17 Therefore to him that knoweth to do good, and doeth it not, to him it is sin. Inverse16,JamestracesthefailuretotakeGodintoaccountinmakingplanstoits rootcause arrogantpride. The Phillips translation captures the idea well: "You get a certain pride in yourselfinplanningyourfuturewithsuchconfidence."itisthisprideoflife and this arrogant sense of self sufficiency and self importance that John highlightsasacharacteristicofthisworldin1john2:16.seealsoromans 1:30and2Timothy3:4. PeoplenotonlyleaveGodoutoftheirplans,theyactuallybragaboutdoing so.itakecenterstageinplaceofgod.whatihavedone,whaticando.iam aself mademan!arrogantpride. Barclay:"Inlifethereisonesinthatcanbesaidtobethebasisofallothers, andthatisforgettingthatwearecreaturesandthatgodiscreator." "Weassureourselvesthattimeisonoursideandatourdisposal(todayor tomorrow). We make our plans as if personal ability (and trade) and the profit motive(and get gain) were the only issues to take into account. We overlookourownfrailty;thatourlifeisjustamist;andweignorethateven thesmallprintoflifeisinthehandsofasovereigngod(ifthelordwills)." Commentators are nearly unanimous as viewing verse 17 as a traditional saying thatjameshastakenandusedheretomakehispoint. Notonlydoesthesuddenshifttothethirdpersonsuggestthis,buttheGreek scholarstellusthattheverseitselffitsalittleawkwardlyintotheparagraph. SoitappearstobeacommonsayingofthedaythatJamesasadoptedintohis letter. Verse17findsJamesathisabruptbest. Hemoveswithoutwarningfrom theparticularofverse16tothegeneralofverse17,fromtheevilofthesinof arrogancetoasearchingstatementaboutthesinofomission. "The whole idea of sinning by default has never been given more pointed expression." We may be able to avoid committing forbidden evil, but who caneverseizepositivelyeveryopportunityfordoinggood,andyetthatisthe command. Whatisthepointofthesaying? SomesuggestthatJamesisindirectlyrebukingthemerchantsforfailingtodo goodthingswiththeirmoney,andweknowthatjameshasmuchtosayinhis Page 13 of 15 www.thywordistruth.com

letteraboutrichpeoplewhoclosetheireyestotheneedsofothers.butthat suggestion seems premature here since James is not really focused here on theriches,butinsteadonthethis world onlyplansofsomewhoseekthose riches. More likely James adds the saying as an encouragement to do what he has justcommanded.hehastoldthemwhatisright.iftheynowfailtodoit, theyaresinning.theycannottakerefugeinthepleathattheyhavenotdone anythingpositivelywrong. Sins of omission are as real and serious as sins of commission. In Luke 19:11 27, Jesus told a parable about a servant who failed to use the money with which he was entrusted. What did he do? Nothing, and that was the problem. Wesometimesthinkthatinactionisasafecourse;nothingcouldbefurther fromthetruthwhengodhascommandedaction!inluke12:47,jesussaid, Andthatservantwhoknewhismaster swill,anddidnotpreparehimselfor doaccordingtohiswill,shallbebeatenwithmanystripes. Verses 16 and 17 are not unconnected. In the Greek, the connecting word "therefore" appears at the beginning of verse 17. All such boasting is evil; whoever"therefore"knows Wemightconsideritasmallthingifwefora timeforgethowdependentweareongod,butjamesseesitverydifferently. It is the mark of human pride, which is the mark and curse of fallen man. Here,aboveallplaces,wecannotaffordtofallintothesinofomission. WhatisthispresumptuousnessaboutwhichJamesiswriting? In verse 13, it first touches life today, tomorrow, a year. It is the presumptionthatwecancontinuealiveatwill. Second, it touches choice today or tomorrow we will go, spend a year, trade.itisthepresumptionthatwearemastersofourownlivessothatwe needdonomorethandecideandthenloandbehold,itwillcometopass.it isthepresumptionthatwearemastersofourfateandcaptainsofoursoul. Third,ittouchesability andtradeandgetgain.ofcoursewewillsucceedif wewantto!wecandoit.wecandoanything.wespeaktoourselvesasif life were our right, as if our choices were the only deciding factor, as if we hadinourselvesallthatisneededtomakeasuccessofthings. Howdoweguardagainstpresumptuousness? First,thereisourignorance wedonotknow,jamessays.hisironyisclear heistalkingaboutapersonbusylayingouthisprogramforthenextyear, andyethedoesnotevenknowabouttomorrow. Page 14 of 15 www.thywordistruth.com

Second,thereisourfrailty.Wearebutamist. Third, there is our dependence. We should say"if the Lord wills," and it is therethatjamescomestotheheartofthematter.jamesisnottellingusnot toplan.heistellingusnottoplanthingsapartfromgod.heisbanningthat self important planning that keeps God for Sunday but looks on the other daysasmine. Jamesistellingusnottoforgetourignorance,ourfrailty,andourdependence.Heis tellingusnotplanourday,ourweek,andouryearasifwewerethelordofearth andtime. And we should not forget that James' discussion here is focused on business and commerce. Toooften,peopletrytoleaveGodinthechurchorinthehome,whentheygo offtowork.formanyofus,moretimeisspentatworkandwiththepeople atworkthaninthehomeorchurch.workisourprimarymissionfieldand battlefield!howcanweleavegodbehindwhenweneedhimthemost? Inverse14,itwasthecontentsoftomorrowthatwereunknown.Inverse15,itis theveryexistenceoftomorrowthatisunknown.wedonotreceiveanotherdayby rightorbymechanicallaw,butbythegraceofgod. When we forget our ignorance, our frailty, and our dependence, it is a sign of the proud, boastful, vaunting human spirit, flaunting its supposed independence and self sufficiency.verse16tellsusitisevil,andjamesoffersnoqualificationofthe word. Proverbs3:27 28says: Donotwithholdgoodfromthosetowhomitisdue,whenit is in thepower of your hand to do so.do not say to your neighbor, Go, and come back,andtomorrowiwillgiveit, whenyouhaveitwithyou. Sinshouldneverbetakenlightly,andthatisespeciallytrueofthesinofomission, whichisoftencalledsimplyanoversight.butjamesdoesnottreatitlightlyatall. Page 15 of 15 www.thywordistruth.com